Medicine & Health Products
Description
Safety Shipping Factory Price CjC-1295 without DAC(CAS NO.:863288-34-0)
Product name:CjC-1295 without DAC(2mg/vial)
Alias:Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
CAS:863288-34-0
MF:C165H269N47O46
MW:3647.15
Density:1.45
Appearance: Peptides Lyophilized Powder
Purity:99% min
Key words:CjC-1295 without DAC 863288-34-0 polypeptide GHRP-6 Melanotan-II muscle bodybuilding healthcare
Usage:
CJC 1295 DAC, a long acting GHRH polypeptide, causes the anterior pituitary& acute;s somatotropes to release growth hormone. DAC conjugated CJC 1295, makes this GHRH have a half life of more than a week (approx. 8 days). GHRH is released in pulses in the body which alternate with corresponding pulses of somatostatin (growth-hormone inhibiting-hormone). Ghrelin, released from the gut which circulates and acts as a hunger hormone, has synergistic activity in the body with GHRH and also suppresses somatostatin to make way for the GHRH pulse. Studies shows that combining GHRP with CJC 1295 DAC, significantly increase the release of GH and IGF-1 production.
Read More
Hongkong Yuancheng Saichuang Technology Co., Ltd
Steroid hormone,Pharmaceutical intermediates,Healthcare products,Food addictives,Flavours and fragrances,Plant&Animal Extract
Address: No. 496 Zhongshan Road, Wuchang District,
Wuhan, Hubei
China, 430000
Tel: 86-027-50756211
Fax: 86-027-68886696
